PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BS_C94BD2E9F.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 323aa    MW: 33152.6 Da    PI: 7.6505
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BS_C94BD2E9F.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1244.8e-391473362
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            +al+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+s+
  Traes_2BS_C94BD2E9F.1 14 AEALRCPRCDSANTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRSR 73
                           57899****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-271162IPR003851Zinc finger, Dof-type
PfamPF027011.4E-331671IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3851771IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101955IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
GGGGTGGAVA DPRAEALRCP RCDSANTKFC YYNNYSLSQP RHFCKACKRY WTRGGTLRNV  60
PVGGGCRKNK RSRSSNGSGG RPGSCAVVAS TNAAAGGITS STSMSLPPPG SLSSALGLHG  120
HGSSSLASLL LGSGASGGDH LGLFHAMQSV VSDATAYEMH QQHQTQVDQL LGLGYGAGDA  180
NGSQIHIKPW QQHLQDGAGG LFDGFYAPLL SGSIVPGLEE LHVKAEATAG EHHHHHHQKK  240
ATDGDQQSWD QHPTSSSNVE ANIMASDALM AAAAAASMNP AVSNAATAPT SSPLMYWGNG  300
NIGGSPAAWP DMANCGSSIA TFF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3689790.0AK368979.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2083D03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560166.11e-107PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLW5BNQ80.0W5BNQ8_WHEAT; Uncharacterized protein
STRINGMLOC_21982.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88953041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.11e-28Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]